2024 Cyhr1

Cyhr1

Author: jcgp

August undefined, 2024

http://www.licpathway.net/sedb/download/new/SE_bed/mm10/SE_12_0592_SE_mm10.bed WebCyhr1 cysteine and histidine rich 1 [ (house mouse)] Gene ID: 54151, updated on 8-Nov-2024 Summary Predicted to enable zinc ion binding activity. Located in cytoplasm and …

Cell atlas - CYHR1 - The Human Protein Atlas

WebCYHR1 (HGNC Symbol) Synonyms: CHRP, KIAA0496, MGC13010: Description: Cysteine and histidine rich 1 (HGNC Symbol) Entrez gene summary: Chromosome: 8: Cytoband: … WebCYHR1 Antibody. Applications: ICC/IF, WB, IHC. Reactivity: Human, Mouse. Images: 5. Clonality: Polyclonal. Conjugates: Unconjugated. job level of technology lead in infosys

PrEST Antigen CYHR1 [Catalog No.: ATL-APrEST76449]

WebCYHR1, KIAA0496. Organism names. Organism. Homo sapiens (Human) Taxonomic identifier. 9606 NCBI. Taxonomic lineage. Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo. Accessions. Primary accession. P0DTL6. … WebCYHR1 in human cancer is unknown.16–19 To evaluate the role and signiﬁcance of CYHR1 in ESCC, we established CYHR1 knock-out esophageal cancer cells by using the small interfering RNA (siRNA) transfection method. Then, we performed a functional analysis, used reverse tran-scription-polymerase chain reaction (RT-PCR) to detect the WebCYHR1 is part of cluster 35 Non-specific - Unknown function with confidence i Confidence is the fraction of times a gene was assigned to the cluster in repeated clustering, and … joblib assignment destination is read-only

As a Novel Prognostic Marker, Cysteine/histidine-rich 1 …

CYHR1 Polyclonal Antibody (PA5-66263) - thermofisher.com

WebCYHR1 Gene - Somatic Mutations in Cancer Actionability v8 is now available for download Gene GRCh38 · COSMIC v97 Gene view The gene view histogram is a graphical view of … PROTEIN SUMMARY SECTION OVERVIEW RNA DATA ANTIBODY DATA. CYHR1 INFORMATION. Proteini. Full gene name according to HGNC. Cysteine and histidine rich 1. Gene namei. Official gene symbol, which is typically a short form of the gene name, according to HGNC. CYHR1 (CHRP, KIAA0496, MGC13010) Protein classi. job lianhetech.comWebPre-made anti-CYHR1 monoclonal antibody (mab) is expressed by mammalian cell line as a benchmark antibody for cell culture, ELISA or other affinity binding assay or functional assay development, animal model development, PK/PD model development (Pharmacokinetics & Pharmacodynamic). insulatard ftk

"WebCYHR1 cysteine and histidine rich 1 Location: Also known as: KIAA0496, MGC13010, CHRP Ensembl: ENSG00000187954 NCBI Entrez Gene: 50626 Perturbation Effects … " - Cyhr1

Cyhr1

WebCYHR1 has 3,540 functional associations with biological entities spanning 8 categories (molecular profile, organism, chemical, functional term, phrase or reference, disease, … WebCYHR1. 1110031M01Rik, AU042374, Chrp. cysteine and histidine rich 1. GO Process (0) GO Function (1) GO Component (3) Gene Ontology Molecular Function. protein binding . Gene Ontology Cellular Component. cytoplasm ; nuclear envelope ; nucleoplasm .

Did you know?

WebMar 21, 2024 · lnc-CYHR1-1 is an RNA Gene, and is affiliated with the lncRNA class. Additional gene information for lnc-CYHR1-1 Gene Search for lnc-CYHR1-1 at DataMed Search for lnc-CYHR1-1 at HumanCyc WebAcronym. Definition. PCHR. Palestinian Centre for Human Rights. PCHR. Personally Controlled Health Record (healthcare) PCHR. Philadelphia Commission on Human …

WebDesaki, R., Sawada, G., Okumura, H., Ikeda, R., Tanabe, K., Komatsu, H., … Natsugoe, S. (2015). As a Novel Prognostic Marker, Cysteine/histidine-rich 1 (CYHR1) is a ... WebJan 1, 2005 · The bovine CYP11B1 gene is positioned in chromosomal region BTA14q12 ( Kaupe et al., 2004 ). More precisely, the CYP11B1 gene is located from 1,302,902 bp to 1,310,580 bp on chromosome 14. ......

Web616635 - cysteine- and histidine-rich protein 1; cyhr1 - chrp;; kiaa0496 - zftraf1 WebEach montage below shows randomly selected individual cell images for the same target gene separated by sgRNA, along with an example montage of cells expressing a non-targeting negative control sgRNA at the bottom. sgRNA labels in the montages correspond to the numbered sgRNA sequences in the gene info table above.

WebCysteine/histidine-rich 1 (CYHR1) was ﬁrst discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a rela- tionship between the …

WebPharos : Target Details - CYHR1 Jump to section: close Descriptive Data Protein Summary Protein Classes IDG Development Level Summary Expression Data Protein Sequence … joblib.load pop from empty listWebHuman diseases caused by Cyhr1 mutations The analysis uses data from IMPC, along with published data on other mouse mutants, in comparison to human disease reports in … job level of operations executive in infosysWebse_chr se_start se_end se_id cell_id se_rank se_ele_num se_cas_value se_con_value se_gene_overlap se_gene_proximal se_gene_closest se_gene_prestige se_gene_closest_active se_snp_n job lewisham councilWebHigh CYHR1 expression is associated with Esophageal Squamous Cell Carcinoma. ... insulatard nph precioWebIt's the GeneMedi's summary page for Target/Biomarker Introduction of CYHR1. The page also collects GeneMedi's different modalities and formats products for CYHR1 in therapeutics/drug discovery and IVD diagnostics, which is including antibody, ADC, bispecific, antigen, ORF vector, VLP, etc. With GeneMedi's target-insight database-GM … insula shutter online subtitratWebID: CYHR1_HUMAN DESCRIPTION: RecName: Full=Cysteine and histidine-rich protein 1; SUBUNIT: Interacts with LGALS3 (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Cytoplasm, perinuclear region (By similarity). Note=Shows a prominent perinuclear and cytoplasmic localization (By similarity). SIMILARITY: Belongs to the … joblib memory cache clearWebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% … joblib in machine learning